PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.E04081.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family M-type_MADS
Protein Properties Length: 264aa    MW: 29058.2 Da    PI: 8.2793
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.E04081.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF52.27.8e-171052244
                    ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTS CS
          SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstg 44
                     i+n s r  t+ kR +g++KK +EL +LC+++++v++++++g
  Pahal.E04081.1 10 WISNASTRRATYKKRCKGLMKKTSELATLCGVKACVVVYGEEG 52
                    69***************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006616.82152IPR002100Transcription factor, MADS-box
SMARTSM004322.9E-17162IPR002100Transcription factor, MADS-box
CDDcd002662.65E-26285No hitNo description
PRINTSPR004045.1E-9323IPR002100Transcription factor, MADS-box
SuperFamilySSF554559.16E-21396IPR002100Transcription factor, MADS-box
PfamPF003198.4E-161152IPR002100Transcription factor, MADS-box
PRINTSPR004045.1E-92338IPR002100Transcription factor, MADS-box
PRINTSPR004045.1E-93859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 264 aa     Download sequence    Send to blast
MARKKVSLKW ISNASTRRAT YKKRCKGLMK KTSELATLCG VKACVVVYGE EGGAQQPEVW  60
PSPPEARRIL QKFKAMPEIG RFKKAQSQED LIQSRISKLR DQVGKLDLAN REHETSRLLH  120
ESMDGRRPGL VCTNVEELAN LRWMVETKMA RVKELLQQQI ASQVALPKHP ASSSAHPQAS  180
YAAEMQALAE SDDLQPLQQD WPTYPVPSEG ELLGDVVCNA IASTSNGCAS PSSNGGDMTQ  240
TPNLDFCSGF PWAQDVFPLS TME*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004971693.11e-124PREDICTED: agamous-like MADS-box protein AGL80
TrEMBLK3XQK21e-124K3XQK2_SETIT; Uncharacterized protein
STRINGSi004188m1e-124(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP36336202
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G05860.21e-25M-type_MADS family protein